+ Konuyu Yanıtla
1 den 4´e kadar toplam 4 ileti bulundu.
  1. #1
    Kayıt Tarihi
    Oct 2015
    Nerede
    izmir
    İletiler
    2
    Dilekçeler Sözleşmeler
    0
    Dosya Yükleme
    0

    Tanımlı Veraset ilamından sonra taşınmazlar için yapılması gerekenler

    Öncelikle herkese merhabalar,
    Forumda konu ile ilgili yada benzer başlıkları incelememe rağmen kafamın karışıklığını gideremediğim için bu başlık açma gereği duydum.
    Babamı bir hafta önce kaybetmiş bulunmaktayız. Cenaze işlemlerinden sonra varisler (annem, kardeşim ve ben) olarak noterden veraset ilamını çıkardık. Ardından babamın emeklisi olduğu bankaya maaşının anneme geçmesi için başvurduk. Bu arada hesabında bulunan para da mevcut kredisinin karşılayabildiği kadar kısmı için banka tarafından mahsup edildi. Kafamın karıştığı nokta bundan sonrası için. Sanırım vergi dairesine gitmemiz gerekecek... Babamın bir arabası ve memleketinde kardeşleriyle ortak dükkan ve arsa, arsa payı şeklinde de bir tarlaları var. Vergi dairesine başvurmadan önce bu mallar için ne gibi bir yol izlemem gerekiyor? Memlekete giderek bu taşınmazlar için tapu örneği vs almam mı gerek öncelikle? Yoksa vergi dairesine başvurduktan sonra mı temin etmeliyim?
    Saygılar.



    Hukuki NET Güncel Haber

    Veraset ilamından sonra taşınmazlar için yapılması gerekenler konulu yargıtay kararı ara
    Veraset ilamından sonra taşınmazlar için yapılması gerekenler konulu hukuk haber

  2. # Nedir?
    Tavsiye Soru Cevap
    Kayıt Tarihi
    Bugün
    Nerede
    Avukat Dünyası
    İletiler
    Ne kadar?
     
  3. #2
    Kayıt Tarihi
    Mar 2013
    Nerede
    ÇORUM
    İletiler
    656
    Dilekçeler Sözleşmeler
    0
    Dosya Yükleme
    0

    Tanımlı Cevap: Veraset ilamından sonra taşınmazlar için yapılması gerekenler

    En geç 4 ay içinde Veraset Vergi Dairesi’ne müracaat ederek Veraset Beyannamesi veriniz.
    Veraset intikal vergisi işlemlerini tamamladıktan sonra intikal eden mal varlığının devir işlemleri için ilgili kurumlara başvurunuz. Merhumun;
    a) Gayrimenkulu varsa İl Tapu Sicil Müdürlüğü’ne,

    b) Maaşı için bağlı olduğu Sosyal Güvenlik Kurumu’na, (Bilgi için www.sgk.gov.tr )

    c) Arabası varsa il/ilçe Trafik Tescil Müdürlüğü’ne,

    d) Bankadaki menkul değerleri için bankasına başvurunuz.

    undan sonraki işlem sırası ölen kişiden kalan gayrimenkuller ile ilgili (verilmiş de olsa) bağlı bulunduğu belediyeye emlak beyanını vermektir. Bunun içinde;
    a– emlak beyanı
    b– veraset ilamı
    c– varislerin adı, soyadı ve imzası listesi ile müracaat edilir.
    İlgili emlak veya beyanlarında ikişer adet arkalı önlü fotokopi çektirilmesi gerekir. Birer suretini belediyeden aslı gibidir diye onaylatılması gerekir. Bu işlemlerin neticesinde ilgili memur tahakkuk fişi verir. Ve ödenecek vergi varsa ödenir.
    Bu işlemlerden sonra sıra VERASET BEYANI‘nı vermeye gelmiştir. Veraset beyanı vefat ettiği tarihten itibaren üç ay içinde ilgili veraset vergi dairesine verilmelidir. Verilmez ise cezalı duruma düşülür. Veraset beyanını verirken gerekli belgeler,
    a) Tapu veya tapular
    b) Vefat edenin banka veya bankalarda parası var ise bunların dökümü, hisse senedi, tahlil, telefon, araba gibi vs. menkul malları varsa bunların dökümü ve birer fotokopileri ( vergi dairesinin isteğine göre borçlar var ise bunların belgeleri ile birlikte yazılmaları gerekir)
    c) Veraset İlamı
    d) Tastikli Emlak Beyanları
    e) Muhtardan Ölüm İlmuhaberi
    doldurmuş olduğumuz veraset beyannamesine eklenerek veraset vergi dairesine verilir. Burada doldurmuş olduğumuz veraset beyannamesinde ikişer fotokopi çektirip birini veraset vergi dairesine diğerini de bir suret almalıyız.
    Bu işlemler bittikten sonra verilmiş olunan veraset beyanı komisyona girer. Komisyon beyanı değerlemeye alır, beyan edildiği değerlerden farklı değerler çıkarsa değerlerinin üzerine eklenir, bundan sonra varisler adına vergi çıkmış ise her kişi adına ayrı ayrı tahakkuk fişi çıkarılır. Bu fişlere göre vergileri varis veya varisler 5 yılda 10 eşit taksitte öderler. Bunların ödeme zamanı mali yıl içinde mart ve kasım aylarıdır. Beyan ettiğimiz gayrimenkullerden birinin satılması gerektiği zaman satılacak olan gayrimenkulün vergisinin tamamının ödenmiş olması gerekmektedir. Ancak bu şartla satış yazısı alınır. Bu durumda İŞTİRAK HALİNDE MÜLKİYET’e sahip olurlar.( yani toplu halde)
    Bundan sonra varisler isterlerse ilgili tapu sicil müdürlüğüne veya tapu sicil müdürlüklerine müracaat ederek intikal işlemini yaptırarak kalan mirası MÜŞTEREK MÜLKİYET‘e dönüştürürler, yani hisselendirirler. Bu işlemi yaparken tüm varislerin tapuda hazır bulunmaları veya bir kişiyi vekil tayin etmeleri gerekir. Bunun içinde noterden vekalet verilmesi gerekir.
    Öleni bıraktığı mallarından borçları daha fazla ise varisleri isterse REDDİ MİRAS yapabilirler. Yani kalan malları ve borçları kabul etmezler. Bu mallar devlete kalır. Devlette bu malları satar veya satmaz bu borçları öder. Böyle durumlarda alacakları bundun böyle devlet ile muhatap olurlar.

    Umarım yardımcı olmuştur.
    Milletlerin Yargı Yetkisi Bağımsızlığın Birinci Şartıdır.Adliye Güçleri Bağımsız Olmayan Bir Milletin Devlet Durumunda Varlığı Kabul Olunamaz.

  4. #3
    Kayıt Tarihi
    Oct 2015
    Nerede
    izmir
    İletiler
    2
    Dilekçeler Sözleşmeler
    0
    Dosya Yükleme
    0

    Tanımlı Cevap: Veraset ilamından sonra taşınmazlar için yapılması gerekenler

    Teşekkür ederim. Yapılacak işlerin sırası hep kafa karışıklığı yaratıyor maalesef. Mesela bizim durumumuzda babamın emeklisi olduğu banka mevcut kredisinin yettiği kadar kısmını kapatma amaçlı babamın hesabını kapattı. Vergi dairesiyle ilgili işlemlere başlamadık henüz, bu durum başımıza iş açar mı diye düşündürdü beni.

  5. #4
    Kayıt Tarihi
    Apr 2005
    Nerede
    İZMİR
    İletiler
    19.486
    Dilekçeler Sözleşmeler
    0
    Dosya Yükleme
    0

    Tanımlı Cevap: Veraset ilamından sonra taşınmazlar için yapılması gerekenler

    Taşınmazin bulundugu il, ilce tapu mudurlugune basvurarak islemlere baslayabilirsiniz. Gereken yonlendirmeler oradan yapilacaktir zaten.
    Tapu dairesindeki islemler sirasinda vergi dairesine yonlendirildiginizde, orada gereken bilgi verilip, islemler yapilmaya baslanir.

+ Konuyu Yanıtla

Benzer Konular :

  1. Veraset ilamından sonra borç öğrenildiğinde borca batık tespiti yapılabilir mi?
    Veraset ilamı verdikten sonra babamdan iş mahkemesi kararı ile bana büyük miktarda borç kaldığını öğrendim. Mirasçı oldugum için mahkeme kağıdı bana...
    Yazan: bunt8 Forum: Miras Hukuku
    Yanıt: 0
    Son İleti: 04-05-2012, 14:14:13
  2. Veraset İlamı ve Reddi Miras Sonrası Yapılması Gerekenler Hakkında
    Merhaba, Annemi Ağustos ayında kaybettik. Benim dışımda 2 üvey kardeşimde mirasçı olarak bulunmakta. Mahkemeye Veraset İlamı davası için ve aynı...
    Yazan: winnie_e Forum: Miras Hukuku
    Yanıt: 1
    Son İleti: 02-11-2011, 02:07:32
  3. Veraset ilamından sonra yapılacaklar
    Merhaba değerli hukukçular.. Sizlerden bir konuda daha yardım rica ediyorum. Veraset ilamımız çıktı.. Peki şimdi intikal için hangi yolları takip...
    Yazan: _BeRRa_ Forum: Miras Hukuku
    Yanıt: 3
    Son İleti: 22-05-2009, 14:44:47
  4. Veraset ilamından sonra ne yapılacak
    Arkadaşlar merhaba. yaklaşık 20 gün önce babam vefat etti.Öncelikle sulh ceza mahkemesinden benım dışındaki diğer mirascılara ait veraset ilamı...
    Yazan: gaffur130 Forum: Miras Hukuku
    Yanıt: 1
    Son İleti: 15-08-2008, 14:11:47
  5. Veraset ilamından sonra ne olacak
    Merhaba babamı 2 yıl önce kaybettik.Veraset ilamını çıkarttık daha sonra veraset intikal vergisini ödedik bundan sonra bir işlem yapmamız gerekiyormu...
    Yazan: alsegin Forum: Miras Hukuku
    Yanıt: 1
    Son İleti: 31-07-2008, 11:34:31

Bu sayfada bulunan kavramlar:

veraset ili alindiktan sonra neler yapilir

2018 veraset ilami ve intikal nasil yapilir sirasiyla hangi islemler yapilacak

olumdensonrakalanev.icinyapilacakislemler

veraset

bugun tapuda herkesin irasi uzerine ciktimi

veraset ilami noterde. ne kadar surer

miras icin yapilmasi gerekenler

veraset ilami alindiktan sonra ne yapilir

http:www.hukuki.netshowthread.php124933-Veraset-ilamindan-sonra-tasinmazlar-icin-yapilmasi-gerekenler

veraset ilamini aldiktan sonra yapilmasi geteken islemler

varisler tapu tasinmaz kaydini nerelerde kullanacak

veraset ilami ciktiktan sonra mal baylasim suresi

veraset ilami ciktiktan sonra

veraset ilamindan sonra yapilmasi gerekenler

kardesime vekalet veraset ilami almasi icin

veraset ilamindan sonra yapilacaklar

noterden veraset ilani almak icin varislerin tamaminin bulunmasi gerekirmi

olum sonrasi veraset

butun tasinmazlar icin veraset ilami ayri ayrimi cikartiliyor

veraset ilanindan sonra ne olur

verasetname cikardim borca batik

intikal masraf

Forum

İlgili Hukuk terimleri

İnternet Araçları

İnternet Araçları

Yetkileriniz

  • Yeni konu açma yetkiniz yok
  • Konuya cevap verme yetkiniz yok
  • Dosya ekleme yetkisi yok
  • İleti düzenleme yetkisi yok
  •  



Hukuk Blog |  2019 tarihli Yasal Siteler Dizini |  Arabulucu |  Hukuk Kitapları |  Fiyat1 |  Alman Hukuku |  Özel Güvenlik AŞ. |  İş İlanları |  Ankahukuk |  Psikolog |  Taşınmaz ilanları |  Internet Rehberi |  Türkiye Portalı |  Site Ekleme |  Türkçe-İngilizce Sözlük |  Sihirli Kadın |  Sağlık |  Satılık Düşecek Domainler |  Terapi  |  Berk Gürman |  Phukuk |  Bayefendi |  Arabuluculuk Eğitim Merkezi |  AfternicAlanadı satış (Domain alımı) | 

™ Marka tescili, Patent ve Fikri mülkiyet hakları nasıl korunuyor?
Hukuki.Net’in Telif Hakları ve 2014-2019 yılları arası Marka Tescil Koruması Levent Patent tarafından sağlanmaktadır.
♾️ Makine donanım yapı ve yazılım özellikleri nedir?
Hukuki.Net olarak dedicated hosting serveri bilfiil yoğun trafiği yönetebilen CubeCDN, vmware esx server, hyperv, virtual server (sanal sunucu), Sql express ve cloud hosting teknolojisi kullanmaktadır. Web yazılımı yönünden ise content management (içerik yönetimi) büyük kısmı itibari ile vb olup, wordress ve benzeri çeşitli kodlarla oluşturulan bölümleri de vardır.
Hangi Diller kullanılıyor?
Anadil: 🇹🇷 Türkçe. 🌐 Yabancı dil tercüme: Masaüstü sürümünde geçerli olmak üzere; İngilizce, Almanca, Fransızca, İtalyanca, İspanyolca, Hintçe, Rusça ve Arapça. (Bu yabancı dil çeviri seçenekleri ileride artırılacak olup, bazı internet çeviri yazılımları ile otomatik olarak temin edilmektedir.
Sitenin Webmaster, Hostmaster, Güvenlik Uzmanı, PHP devoloper ve SEO uzmanı kimdir?
👨‍💻 Feyz Pazarbaşı [İstanbul] vd.
® Reklam Alanları ve reklam kodu yerleşimi nasıl yapılıyor?
Yayınlanan lansman ve reklamlar genel olarak Google Adsense gibi internet reklamcılığı konusunda en iyi, en güvenilir kaynaklar ve ajanslar tarafından otomatik olarak (Re'sen) yerleştirilmektedir. Bunların kaynağı Türkiye, Amerika, Ingiltere, Almanya ve çeşitli Avrupa Birliği kökenli kaynak kod ürünleridir. Bunlar içerik olarak günlük döviz ve borsa, forex para kazanma, exim kredileri, internet bankacılığı, banka ve kredi kartı tanıtımları gibi yatırım araçları ve internetten para kazanma teknikleri, hazır ofis kiralama, Sigorta, yabancı dil okulları gibi eğitim tanıtımları, satılık veya kiralık taşınmaz eşyalar ve araç kiralama, ikinci el taşınır mallar, ücretli veya ücretsiz eleman ilanları ile ilgili bilimum bedelli veya bedava reklamlar, rejim, diyet ve özel sağlık sigortası gibi insan sağlığı, tatil ve otel reklamları gibi öğeler içerebilir. Reklam yayıncıları: ads.txt dosyası.
‼️ İtirazi kayıt (çekince) hususları nelerdir?
Bahse konu reklamlar üzerinde hiçbir kontrolümüz bulunmamaktadır. Bu sebep ile özellikle avukat reklamları gibi Avukatlık kanunu vs. mesleki mevzuat tarafından kısıtlanmış, belirli kurallara tabi tutulmuş veya yasaklanmış tanıtımlardan yasal olarak sorumlu değiliz.
📧 İletişim ve reklam başvuru sayfası nerede, muhatap kimdir?
☏ Sitenin 2019 yılı yatırım danışmanı ile irtibat ve reklam pazarlaması için iletişim kurmanız rica olunur.